LL-37 5 mg
LL-37 5 mg is a high-purity synthetic antimicrobial peptide developed for advanced laboratory research, biochemical analysis, and controlled in-vitro studies. Researchers use this research-grade peptide in experimental workflows that require consistent quality, dependable performance, and reproducible results. Its well-characterised structure makes it suitable for innate immunity research, biochemical assays, and structural investigations.
Each vial contains 5 mg of LL-37 as a sterile, lyophilised powder. Furthermore, HPLC testing verifies a purity of 98% or higher, while endotoxin levels remain at ≤5 EU/mg to support sensitive laboratory procedures. Every batch also includes a Certificate of Analysis (COA), allowing researchers to verify product quality and maintain complete batch traceability.
Molecular Information
- Peptide: LL-37
- Synonyms: LL-37 Peptide, Cathelicidin LL-37
- CAS Number: 259061-47-3
- Sequence: [LL-37, 37 aa]
- Length: 37 amino acids
- Molecular Formula: C₂₀₃H₃₁₇N₅₅O₄₉
- Molecular Weight: 4493.3 g/mol
- Content: 5 mg (lyophilised)
- Purity: ≥98% (HPLC-verified)
- Endotoxin: ≤5 EU/mg
Additionally, the freeze-dried format helps preserve peptide stability during storage and transportation. As a result, laboratories can maintain consistent sample quality throughout immunological studies, biochemical assays, and structural analysis. The high-purity formulation also supports reliable and reproducible experimental outcomes.
For long-term storage, keep the vial at -20°C in a dry environment protected from light. During short-term laboratory use, store the product at 2-8°C under standard cold-chain conditions. Also, protect the vial from moisture and minimise repeated freeze-thaw cycles to preserve peptide integrity.
We supply every lot with a Certificate of Analysis (COA) to support quality assurance and documentation requirements. Moreover, each batch undergoes quality verification before release to ensure consistent research-grade standards.
For laboratory research only. Do not use this product for human or veterinary applications. Likewise, do not use it for diagnostic, therapeutic, or medical purposes. Finally, qualified laboratory personnel should handle this peptide according to established laboratory safety procedures.
Search-Optimised Keywords:
LL-37 5 mg, LL-37 peptide, LL37 peptide, Cathelicidin LL-37, LL-37 CAS 259061-47-3, LL-37 research peptide, antimicrobial peptide LL-37, synthetic LL-37, laboratory-grade LL-37, high-purity LL-37, research peptides UK, HPLC verified peptide.

