LL‑37 5 mg

CAS Number: 259061‑47‑3 Synonyms: LL‑37 Peptide, Cathelicidin LL‑37 Quantity: 5 mg (lyophilised)

Key Features

• Purity: ≥ 98% (HPLC‑verified)
• Endotoxin: ≤ 5 EU/mg
• Form: Freeze‑dried (lyophilised) powder
• Documentation: COA supplied with every lot

Peptide Information

• Sequence: [LL-37, 37 aa]
• Length: 37 amino acids
• Molecular Formula: C₂₀₃H₃₁₇N₅₅O₄₉
• Molecular Weight: 4493.3 g/mol
• Classification: Synthetic antimicrobial peptide for research workflows (innate immunity studies, biochemical assays, structural analysis)

Storage & Stability

• Long‑term: –20 °C, dry and protected from light
• Short‑term: Stable at 2–8 °C
• Note: Avoid repeated freeze–thaw cycles

Intended Use

For laboratory research only. Not for human or veterinary use. Not approved for diagnostic, therapeutic, or medical applications. Handle using appropriate laboratory safety practices.

Why Choose LL‑37 5 mg?

• High‑purity synthetic peptide suitable for sensitive immunological and biochemical systems
• Full batch traceability
• COA included with every lot
• Lyophilised for extended stability and ease of handling

Search‑Optimised Keywords

LL‑37, LL‑37 peptide, Cathelicidin LL‑37, LL‑37 CAS 259061‑47‑3, LL‑37 5 mg, LL‑37 research peptide, antimicrobial peptide LL‑37, synthetic LL‑37, LL‑37 laboratory reagent